PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa09g088800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 1173aa    MW: 132802 Da    PI: 7.2573
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa09g088800.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B344.33.1e-14692196
                    EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3  1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95
                    ffk l     + s+ l++p  f+ ++ +g  e++kt +l++  s   W+vkl  ++k+    lt+GWkeF+ a++L+ gD+v+F+ +  ++  ++v+
  Csa09g088800.1  6 FFKPL--LPGFHSH-LTIPVAFFLKYiKGRDEQKKTARLRSdASKIIWNVKL--DGKR----LTDGWKEFALAHNLRIGDIVIFRQE--RDLAFYVT 91
                    66666..5667777.************77778999*****9677799*****..9999....***********************44..44444665 PP

                    E CS
              B3 96 v 96
                    +
  Csa09g088800.1 92 L 92
                    5 PP

2B370.81.8e-22129215490
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sef 90 
                     + + +++l+ + l +pk f++e+g ++ +s +++l++e+grsW++k++ + + g+++ ++GW +F++angLk+gD+v+Fkl++r +++
  Csa09g088800.1 129 ANVAPSSLRYDSLLFPKAFVRENGVVT-GSGEIVLMNEKGRSWTLKMKQKPSCGTIYVRGGWINFCDANGLKSGDTVTFKLIQRgRTR 215
                     567789999999***********9885.666****************99999999***************************973333 PP

3B368.87.7e-22275366497
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                     + + +++l+ + ++lpkkf++e+g+ + ++ +++l++++grsW++ l+ +k  g++ +++GWk+F++angL +g +++Fkl++ ++++l+++++
  Csa09g088800.1 275 ASIAPSSLRYDTMYLPKKFMRENGIYT-KHGEIILMNQKGRSWTLDLKRKKWCGTFCIKRGWKSFCRANGLSAGSIITFKLIK-KRGTLTLRLI 366
                     5678899999*************8775.5569***************98888899**************************98.7777777765 PP

4B355.97.6e-18428525199
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE...EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy.rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                     f++ ++++++ + + l+lp +f++ +g++ke+  ++tl d++g++W+ kl   + ks+r  + +GWk+F +an +k+++++ ++l++++e+++v+
  Csa09g088800.1 428 FVTLTLTPYNVSASVLRLPIPFTRMNGIDKET--KMTLLDKQGKKWSTKLHLeDDKSKRLRMVGGWKGFLQANCVKANESIRLELIWEEEKSCVL 520
                     667778999999999***********999655..8***************778999999****************************99999999 PP

                     EEE-S CS
              B3  95 kvfrk 99 
                     k+++k
  Csa09g088800.1 521 KFRSK 525
                     98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.79E-173103IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.1E-213110IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.434396IPR003340B3 DNA binding domain
CDDcd100172.68E-13493No hitNo description
SMARTSM010191.9E-20696IPR003340B3 DNA binding domain
PfamPF023624.5E-91489IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.0E-20120218IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.71E-20124225IPR015300DNA-binding pseudobarrel domain
CDDcd100174.99E-20126220No hitNo description
PROSITE profilePS5086315.961126223IPR003340B3 DNA binding domain
SMARTSM010195.8E-27127223IPR003340B3 DNA binding domain
PfamPF023621.4E-20128216IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.5E-22264358IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.16E-20270369IPR015300DNA-binding pseudobarrel domain
CDDcd100171.61E-21272367No hitNo description
PROSITE profilePS5086315.65272369IPR003340B3 DNA binding domain
SMARTSM010192.6E-26273369IPR003340B3 DNA binding domain
PfamPF023627.2E-21274366IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.4E-19420524IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.29E-18422523IPR015300DNA-binding pseudobarrel domain
CDDcd100175.56E-15427523No hitNo description
SMARTSM010196.9E-23428526IPR003340B3 DNA binding domain
PROSITE profilePS5086313.324428525IPR003340B3 DNA binding domain
PfamPF023624.9E-17428524IPR003340B3 DNA binding domain
SuperFamilySSF1442321.92E-12572616No hitNo description
PfamPF017531.8E-11574611IPR002893Zinc finger, MYND-type
PROSITE profilePS5086512.588574611IPR002893Zinc finger, MYND-type
PROSITE patternPS013600574611IPR002893Zinc finger, MYND-type
SuperFamilySSF540013.14E-83681992No hitNo description
CDDcd026612.20E-157684989No hitNo description
PROSITE profilePS5023547.986685991IPR028889Ubiquitin specific protease domain
PfamPF004436.3E-39685988IPR001394Peptidase C19, ubiquitin carboxyl-terminal hydrolase
PROSITE patternPS009720686701IPR018200Ubiquitin specific protease, conserved site
Gene3DG3DSA:2.20.210.105.1E-6814879No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006511Biological Processubiquitin-dependent protein catabolic process
GO:0016579Biological Processprotein deubiquitination
GO:0003677Molecular FunctionDNA binding
GO:0036459Molecular Functionthiol-dependent ubiquitinyl hydrolase activity
Sequence ? help Back to Top
Protein Sequence    Length: 1173 aa     Download sequence    Send to blast
MPNKHFFKPL LPGFHSHLTI PVAFFLKYIK GRDEQKKTAR LRSDASKIIW NVKLDGKRLT  60
DGWKEFALAH NLRIGDIVIF RQERDLAFYV TLLGPSCCEI RYGSCLEEET NLEKKKEKKS  120
PNEDSCFVAN VAPSSLRYDS LLFPKAFVRE NGVVTGSGEI VLMNEKGRSW TLKMKQKPSC  180
GTIYVRGGWI NFCDANGLKS GDTVTFKLIQ RGRTRVLRLL AKESKQEAND VSLSTEPESD  240
EDSNIGKIQR QRKMKKSPRR DTESSSSLDP SCFVASIAPS SLRYDTMYLP KKFMRENGIY  300
TKHGEIILMN QKGRSWTLDL KRKKWCGTFC IKRGWKSFCR ANGLSAGSII TFKLIKKRGT  360
LTLRLIPNEG EEEEEISEAN KVESLSRDQE SDEESSHDEK ISQECSRRNE KKRRLRWIAS  420
SSPSKNRFVT LTLTPYNVSA SVLRLPIPFT RMNGIDKETK MTLLDKQGKK WSTKLHLEDD  480
KSKRLRMVGG WKGFLQANCV KANESIRLEL IWEEEKSCVL KFRSKLVLTL FFLSIGLLYF  540
VKKTAAKYFE VGGGSGGFDS DHRRDFMVPD TAECSVCGKE TTKKCSRCKS VRYCSAACQK  600
SDWSSGHKLK CKVFRSTDSS SVGRDDDHDF KASLFGNMSA SKKTKLALVP KMSQSKVALK  660
PTDVLFPYES FVNYFNWDRP IMAPCGLTNC GNSCFANVVL QCLSWTRPLV AYLLERGHKR  720
ECRRNDWCFF CEFETHLDRA NYSRYPFSPT NIISRLPNIG GNLGYGRQED AHELMRFAID  780
MMQSVCLDEF GGEKVVPPRA QETTLIQYIF GGLLQSQVKC TACSNVSDQY ENMMDLTVEI  840
HGDAVSLEEC LDQFTAKEWL QGDNLYKCDR CNDYVKACKR LSISCAPNIL TIALKRFQGG  900
RFGKLNKRIN FPETFDLGPY MSSGGEGSDV YKLYAVIVHL DMLNASFFGH YICYIKDFRG  960
NWYRIDDSKV ENVELEDVLS QRAYMLLYSS PDQQSLRSEE GQDKKKTESS NTESSQEGSV  1020
ESSEVEANDT NVSSLCNGII SHSEDPECEK ESSLSSMSES VPVSEEEGKE VDVRVDTVDS  1080
ESNPSMEMEH DSGTDHQEEV ANGKEDAVVE NLAVDSSCLD VTTPSPSAAT EFIPQEKEHS  1140
DIESKPLEKE QSDTESKPLE KEHLDTEMID AQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4fk5_A7e-33686989143471Ubiquitin carboxyl-terminal hydrolase 8
4fip_E7e-33686989143471Ubiquitin carboxyl-terminal hydrolase 8
4fip_A7e-33686989143471Ubiquitin carboxyl-terminal hydrolase 8
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3603150.0AF360315.1 Arabidopsis thaliana putative ubiquitin carboxyl terminal hydrolase (At2g24640) mRNA, complete cds.
GenBankAY0563660.0AY056366.1 Arabidopsis thaliana putative ubiquitin carboxyl terminal hydrolase (At2g24640) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010429445.10.0PREDICTED: LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 19-like
SwissprotQ9SJA10.0UBP19_ARATH; Ubiquitin carboxyl-terminal hydrolase 19
TrEMBLD7LIB10.0D7LIB1_ARALL; Ubiquitin carboxyl-terminal hydrolase family protein
STRINGAT2G24640.10.0(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.10.0B3 family protein